missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Dystrobrevin beta Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
€ 391.65 - € 590.10
Specifications
| Antigen | Dystrobrevin beta |
|---|---|
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18625775
|
Novus Biologicals
NBP2-38915-25ul |
25 μL |
 € 415.00 € 391.65 / 25µL Save € 23.35 5% Off |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18191169
|
Novus Biologicals
NBP2-38915 |
0.1 mL |
€ 624.00 € 590.10 / 0.10mL Save € 33.90 5% Off |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
Dystrobrevin beta Polyclonal specifically detects Dystrobrevin beta in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.Specifications
| Dystrobrevin beta | |
| Polyclonal | |
| Rabbit | |
| Human | |
| O60941 | |
| 1838 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: MIAAYDSEGRGKLTVFSVKAMLATMCGGKMLDKLRYVFSQMSDSNGLMIFSKFDQ | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| beta-dystrobrevin, DTN-B, dystrobrevin beta, dystrobrevin, beta, MGC17163, MGC57126 | |
| DTNB | |
| IgG | |
| Affinity Purified |
Spot an opportunity for improvement?
Product Title
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.