missing translation for 'onlineSavingsMsg'
Learn More
Learn More
EAAT4 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-48740-25ul
This item is not returnable.
View return policy
Description
EAAT4 Polyclonal antibody specifically detects EAAT4 in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/ Immunofluorescence, Immunohistochemistry (Paraffin)
Specifications
| EAAT4 | |
| Polyclonal | |
| Immunohistochemistry 1:1000 - 1:2500, Immunocytochemistry/ Immunofluorescence 0.25-2 μg/mL, Immunohistochemistry-Paraffin 1:1000 - 1:2500 | |
| EAAT4MGC43671, excitatory amino acid transporter 4, MGC33092, Sodium-dependent glutamate/aspartate transporter, solute carrier family 1 (high affinity aspartate/glutamate transporter), member6, Solute carrier family 1 member 6 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: KQFKTQYSTRVVTRTMVRTENGSEPGASMPPPFSVENGTSFLENVTRALGTLQEMLSFEETVPVPGS | |
| 25 μL | |
| Neuroscience | |
| 6511 | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. | |
| IgG |
| Immunohistochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2), 40% Glycerol | |
| Rabbit | |
| Immunogen affinity purified | |
| RUO | |
| Primary | |
| Human | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction