missing translation for 'onlineSavingsMsg'
Learn More
Learn More
EB2 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP1-84926
This item is not returnable.
View return policy
Description
EB2 Polyclonal antibody specifically detects EB2 in Human, Mouse, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Specifications
| EB2 | |
| Polyclonal | |
| Western Blot 0.04-0.4 ug/mL, Immunohistochemistry 1:200 - 1:500, Immunohistochemistry-Paraffin 1:200 - 1:500 | |
| APC-binding protein EB2, EB1, EB2APC-binding protein EB1, End-binding protein 2, microtubule-associated protein, RP/EB family, member 2, RP1microtubule-associated protein RP/EB family member 2, T-cell activation protein, EB1 family | |
| This antibody was developed against Recombinant Protein corresponding to amino acids: KFYDANYDGKEYDPVEARQGQDAIPPPDPGEQIFNLPKKSHHANSPTAGAAKSSPAAKPGSTPSRPSSAK | |
| 0.1 mL | |
| Cell Biology, Cell Cycle and Replication, Cytoskeleton Markers, Signal Transduction | |
| 10982 | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. | |
| IgG |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol | |
| Rabbit | |
| Immunogen affinity purified | |
| RUO | |
| Primary | |
| Human, Mouse, Rat | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction