missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 15965345

Invitrogen™ EBP1 Polyclonal Antibody

Product Code. 15965345
Change view
Click to view available options
Quantity:
100 μg
Unit Size:
100µg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
15965345 100 μg 100µg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 15965345 Supplier Invitrogen™ Supplier No. PA579779

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Rabbit Polyclonal Antibody

Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 μg/mL. Positive Control - WB: rat liver tissue, NIH3T3 whole cell, HEPG2 whole cell. IHC: rat intestine tissue, mouse intestine tissue, mouse brain tissue.

This gene encodes an RNA-binding protein that is involved in growth regulation. This protein is present in pre-ribosomal ribonucleoprotein complexes and may be involved in ribosome assembly and the regulation of intermediate and late steps of rRNA processing. This protein can interact with the cytoplasmic domain of the ErbB3 receptor and may contribute to transducing growth regulatory signals. This protein is also a transcriptional co-repressor of androgen receptor-regulated genes and other cell cycle regulatory genes through its interactions with histone deacetylases. This protein has been implicated in growth inhibition and the induction of differentiation of human cancer cells. Six pseudogenes, located on chromosomes 3, 6, 9, 18, 20 and X, have been identified.
TRUSTED_SUSTAINABILITY

Specifications

Antigen EBP1
Applications Immunohistochemistry (Paraffin), Western Blot
Classification Polyclonal
Concentration 500 μg/mL
Conjugate Unconjugated
Formulation PBS with 5mg BSA and 0.05mg sodium azide
Gene Pa2g4
Gene Accession No. P50580, Q6AYD3, Q9UQ80
Gene Alias 38kDa; AA672939; Cell cycle protein p38-2G4 homolog; Ebp1; ErbB-3 binding protein 1; ErbB3-binding protein 1; ErbB3-binding protein Ebp1; hG4 1; hG4-1; IRES-specific cellular trans-acting factor 45 kDa; ITAF45; MGC81621; MGC94070; Mpp1; p38 2G4; p38-2G4; Pa2g4; Plfap; proliferation-associated 2G4; proliferation-associated 2G4, 38kD; proliferation-associated 2G4, 38kDa; proliferation-associated protein 1; Proliferation-associated protein 2G4; protein p38-2G4; si:dz150i12.2; wu:fb19b11; wu:ft56d05; zgc:86732
Gene Symbols Pa2g4
Host Species Rabbit
Immunogen A synthetic peptide corresponding to a sequence at the C-terminus of human EBP1 (138-178aa RKADVIKAAHLCAEAALRLVKPGNQNTQVTEAWNKVAHSFN).
Purification Method Antigen affinity chromatography
Quantity 100 μg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 18813, 288778, 5036
Target Species Human, Mouse, Rat
Content And Storage -20°C
Product Type Antibody
Form Lyophilized
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.