missing translation for 'onlineSavingsMsg'
Learn More
Learn More
ECHDC1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
€ 415.00 - € 572.00
Specifications
| Antigen | ECHDC1 |
|---|---|
| Dilution | Immunocytochemistry/ Immunofluorescence 0.25-2 μg/mL |
| Applications | Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18627857
|
Novus Biologicals
NBP2-68625-25ul |
25 μL |
€ 415.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18674387
|
Novus Biologicals
NBP2-68625 |
100 μg |
€ 572.00
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
ECHDC1 Polyclonal antibody specifically detects ECHDC1 in Human samples. It is validated for Immunocytochemistry/ ImmunofluorescenceSpecifications
| ECHDC1 | |
| Immunofluorescence | |
| Unconjugated | |
| Rabbit | |
| Lipid and Metabolism | |
| PBS (pH 7.2) and 40% Glycerol | |
| 55862 | |
| IgG | |
| Protein A purified |
| Immunocytochemistry/ Immunofluorescence 0.25-2 μg/mL | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human | |
| dJ351K20.2, DKFZp762M1110, enoyl CoA hydratase domain containing 1, enoyl Coenzyme A hydratase domain containing 1, enoyl-CoA hydratase domain-containing protein 1, FLJ40827 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: SGVMMLQLLEKVIELENWTEGKGLIVRGAKNTFSSGSDLNAVKSLGTPEDGMAVCMFMQNTLTRFMRLPLI | |
| Primary | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title