missing translation for 'onlineSavingsMsg'
Learn More
Learn More
EEF2K Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-58790-25ul
This item is not returnable.
View return policy
Description
EEF2K Polyclonal specifically detects EEF2K in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.
Specifications
| EEF2K | |
| Polyclonal | |
| Immunocytochemistry/Immunofluorescence 1-4 μg/mL | |
| Calcium/calmodulin-dependent eukaryotic elongation factor 2 kinase, calcium/calmodulin-dependent eukaryotic elongation factor-2 kinase, EC 2.7.11, EC 2.7.11.20, eEF-2 kinase, eEF-2Kcalmodulin-dependent protein kinase III, elongation factor-2 kinase, eukaroytic elongation factor 2 kinase, eukaryotic elongation factor 2 kinase, eukaryotic elongation factor-2 kinase, HSU93850, MGC45041 | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles. |
| Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| PBS (pH 7.2), 40% Glycerol with 0.02% Sodium Azide | |
| EEF2K | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:GFDYLLKAAEAGDRQSMILVARAFDSGQNLSPDRCQDWLEALHWYNTALEMTDCDEGGEYDGMQDEPRYMMLAREAEMLFTG | |
| 25 μL | |
| Cancer, Hypoxia Signaling | |
| 29904 | |
| Human | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Haben Sie Verbesserungsvorschläge?Übermitteln Sie eine inhaltliche Korrektur