missing translation for 'onlineSavingsMsg'
Learn More
Learn More
EGFL8 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-49327
This item is not returnable.
View return policy
Description
EGFL8 Polyclonal antibody specifically detects EGFL8 in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/ Immunofluorescence, Immunohistochemistry (Paraffin)
Specifications
| EGFL8 | |
| Polyclonal | |
| Immunohistochemistry 1:50 - 1:200, Immunocytochemistry/ Immunofluorescence 0.25-2 μg/mL, Immunohistochemistry-Paraffin 1:50 - 1:200 | |
| C6orf8, chromosome 6 open reading frame 8, EGF-like protein 8, EGF-like-domain, multiple 8, epidermal growth factor-like protein 8, FLJ44493, FLJ52513, FLJ75166, FLJ97375, MGC44938, MGC59719, NG3FLJ78536, Vascular endothelial statin-2, VE-statin-2 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: FNTAGSFTCGCPHDLVLGVDGRTCMEGSPEPPTSASILSVAVREAEKDERALKQEIHELRG | |
| 0.1 mL | |
| Primary | |
| Human | |
| Purified |
| Immunohistochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2), 40% Glycerol | |
| Rabbit | |
| Immunogen affinity purified | |
| RUO | |
| 80864 | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. | |
| IgG |
Corrección del contenido de un producto
Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.
Título del producto
¿Detecta una oportunidad de mejora?Comparta una corrección de contenido