missing translation for 'onlineSavingsMsg'
Learn More
Learn More
EGLN2/PHD1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-76551
This item is not returnable.
View return policy
Description
EGLN2/PHD1 Polyclonal specifically detects EGLN2/PHD1 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.
Specifications
| EGLN2/PHD1 | |
| Polyclonal | |
| Immunocytochemistry/Immunofluorescence 1 - 4 μ/mL | |
| Q96KS0 | |
| EGLN2 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids: PLSQALPQLPGSSSEPLEPEPGRARMGVESYLPCPLLPSYHCPGVPSEASAGSGTPRATATSTTASPLRDGFGGQDGGE | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
| Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| PBS, pH 7.2, containing 40% glycerol with 0.02% sodium azide | |
| DKFZp434E026, EC 1.14.11, EC 1.14.11.-, egl nine homolog 2, egl nine homolog 2 (C. elegans), EIT6, Estrogen-induced tag 6, FLJ95603, HIF-PH1, HIFPH1 EGL nine (C.elegans) homolog 2, HIF-prolyl hydroxylase 1, HPH-1, HPH-3, Hypoxia-inducible factor prolyl hydroxylase 1, PHD1, Prolyl hydroxylase domain-containing protein 1 | |
| Rabbit | |
| 100 μL | |
| 112398 | |
| Human | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction