missing translation for 'onlineSavingsMsg'
Learn More
Learn More
EHD1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody has been used in 1 publication
€ 280.00 - € 605.00
Specifications
| Antigen | EHD1 |
|---|---|
| Dilution | Western Blot 0.04-0.4 μg/mL, Immunocytochemistry/Immunofluorescence 0.25-2 μg/mL, Knockout Validated |
| Applications | Western Blot, Immunocytochemistry, Immunofluorescence, Immunoassay |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18001576
|
Novus Biologicals
NBP2-56035 |
100 μL |
€ 605.00
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18620309
|
Novus Biologicals
NBP2-56035-25ul |
25 μL |
€ 280.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
EHD1 Polyclonal specifically detects EHD1 in Human samples. It is validated for Western Blot, Immunocytochemistry/Immunofluorescence, Knockout Validated, Knockdown Validated.Specifications
| EHD1 | |
| Western Blot, Immunocytochemistry, Immunofluorescence, Immunoassay | |
| Unconjugated | |
| RUO | |
| PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
| 10938 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:MEQPGTAASPVSGSMFSWVSKDARRKKEPELFQTVAEGLRQLYAQKLLP | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Western Blot 0.04-0.4 μg/mL, Immunocytochemistry/Immunofluorescence 0.25-2 μg/mL, Knockout Validated | |
| Polyclonal | |
| Rabbit | |
| Human | |
| EH-domain containing 1 | |
| EHD1 | |
| IgG | |
| Affinity Purified |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title