missing translation for 'onlineSavingsMsg'
Learn More
Learn More
EIF1AD Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-31591-25ul
Dieser Artikel kann nicht zurückgegeben werden.
Rückgaberichtlinie anzeigen
Beschreibung
EIF1AD Polyclonal specifically detects EIF1AD in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.
Spezifikation
| EIF1AD | |
| Polyclonal | |
| Immunohistochemistry, Immunohistochemistry-Paraffin 1:200 - 1:500 | |
| Q8N9N8 | |
| EIF1AD | |
| This antibody was developed against a recombinant protein corresponding to amino acids: TKRKHVVKEVLGEHIVPSDQQQIVRVLRTPGNNLHEVETAQGQRFLVSMPSKYRKNIWIKRGDFLIVDPIE | |
| 25 μL | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| eukaryotic translation initiation factor 1A domain containing, Eukaryotic translation initiation factor 1A domain-containing protein, haponin, MGC11102, probable RNA-binding protein EIF1AD | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| 84285 | |
| Human | |
| IgG |
Berichtigung von Produktinhalten
Bitte geben Sie uns Ihr Feedback zu den Produktinhalten, indem Sie das folgende Formular ausfüllen.
Name des Produkts
For Research Use Only
Haben Sie Verbesserungsvorschläge?Übermitteln Sie eine inhaltliche Korrektur