missing translation for 'onlineSavingsMsg'
Learn More
Learn More
ELA3A Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-54725
This item is not returnable.
View return policy
Description
ELA3A Polyclonal specifically detects ELA3A in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.
Specifications
| ELA3A | |
| Polyclonal | |
| Immunohistochemistry-Paraffin 1:200 - 1:500 | |
| chymotrypsin-like elastase family member 3A, chymotrypsin-like elastase family, member 3A, EC 3.4.21, EC 3.4.21.70, ELA3A, ELA3elastase 1, elastase 3A, pancreatic, elastase 3A, pancreatic (protease E), Elastase IIIA, elastase-3A, Protease E | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
| CELA3A | |
| This antibody was developed against a Recombinant Protein corresponding to amino acids:LFVHPLWNRSCVACGNDIALIKLSRSAQLGDAVQLASL | |
| 100 μL | |
| Lipid and Metabolism | |
| 10136 | |
| Human | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction