missing translation for 'onlineSavingsMsg'
Learn More
Learn More
ELAVL4 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
€ 190.00 - € 550.00
Specifications
| Antigen | ELAVL4 |
|---|---|
| Dilution | Western Blot 1:500 - 1:2000, ELISA, Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200 |
| Applications | ELISA, Immunohistochemistry, Western Blot, Immunohistochemistry (Paraffin), Immunocytochemistry/Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
30228424
|
Novus Biologicals
NBP3-35160-20ul |
20 μL |
€ 190.00
20µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
30227510
|
Novus Biologicals
NBP3-35160-100ul |
100 μL |
€ 550.00
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
ELAVL4 Polyclonal antibody specifically detects ELAVL4 in Mouse,Rat samples. It is validated for ELISA,Immunohistochemistry,Western Blot,Immunohistochemistry (Paraffin),Immunocytochemistry/ImmunofluorescenceSpecifications
| ELAVL4 | |
| ELISA, Immunohistochemistry, Western Blot, Immunohistochemistry (Paraffin), Immunocytochemistry/Immunofluorescence | |
| Unconjugated | |
| Rabbit | |
| Neuroscience, Vision | |
| PBS (pH 7.3), 50% glycerol | |
| 1996 | |
| IgG | |
| Affinity purified |
| Western Blot 1:500 - 1:2000, ELISA, Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200 | |
| Polyclonal | |
| Purified | |
| RUO | |
| Mouse, Rat | |
| abnormal vision, Drosophila, homolog of, like-4, ELAV (embryonic lethal, abnormal vision, Drosophila)-like 4 (Hu antigen D), HuD, Paraneoplastic encephalomyelitis antigen HuD | |
| A synthetic peptide corresponding to a sequence within amino acids 1-100 of human ELAVL4 (NP_068771.2).,, Sequence:, MVMIISTMEPQVSNGPTSNTSNGPSSNNRNCPSPMQTGATTDDSKTNLIVNYLPQNMTQEEFRSLFGSIGEIESCKLVRDKITGQSLGYGFVNYIDPKDA | |
| Primary | |
| Store at -20°C. Avoid freeze-thaw cycles. |
Individuate un'opportunità di miglioramento?Condividi una correzione di contenuto
Correzione del contenuto del prodotto
Fornite il vostro feedback sul contenuto del prodotto compilando il modulo sottostante.
Titolo del prodotto