missing translation for 'onlineSavingsMsg'
Learn More
Learn More
ELMOD1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
€ 292.00 - € 725.00
Specifications
| Antigen | ELMOD1 |
|---|---|
| Dilution | Western Blot 0.04-0.4 ug/mL, Immunocytochemistry/ Immunofluorescence 0.25-2 ug/mL |
| Applications | Western Blot, Immunocytochemistry |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18496150
|
Novus Biologicals
NBP1-85094 |
0.1 mL |
€ 725.00
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18467730
|
Novus Biologicals
NBP1-85094-25ul |
25 μL |
€ 292.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
ELMOD1 Polyclonal antibody specifically detects ELMOD1 in Human, Mouse samples. It is validated for Western Blot, Immunocytochemistry/ ImmunofluorescenceSpecifications
| ELMOD1 | |
| Western Blot, Immunocytochemistry | |
| Unconjugated | |
| Rabbit | |
| Apoptosis | |
| PBS (pH 7.2) and 40% Glycerol | |
| 55531 | |
| IgG | |
| Immunogen affinity purified |
| Western Blot 0.04-0.4 ug/mL, Immunocytochemistry/ Immunofluorescence 0.25-2 ug/mL | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human, Mouse | |
| DKFZp547C176, ELMO domain containing 1, ELMO domain-containing protein 1, ELMO/CED-12 domain containing 1 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:THFYNIAPEAPTLSHFQQTFCYLMHEFHKFWIEEDPMDIMEFNRVREKFRKRIIKQLQNPDMALCPHFAASEGLINM | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title