missing translation for 'onlineSavingsMsg'
Learn More
Learn More
ELOVL6 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP3-37909-100ul
This item is not returnable.
View return policy
Description
ELOVL6 Polyclonal antibody specifically detects ELOVL6 in Human,Mouse,Rat samples. It is validated for ELISA,Western Blot
Specifications
| ELOVL6 | |
| Polyclonal | |
| Western Blot 1:500 - 1:1000, ELISA | |
| elongation of long chain fatty acids (FEN1/Elo2, SUR4/Elo3-like, yeast), ELOVL fatty acid elongase 6,3-keto acyl-CoA synthase ELOVL6, FAE, fatty acid elongase 2, long-chain fatty-acyl elongase | |
| A synthetic peptide corresponding to a sequence within amino acids 50-150 of human ELOVL6 (NP_076995.1).,, Sequence:, LMNKRAKFELRKPLVLWSLTLAVFSIFGALRTGAYMVYILMTKGLKQSVCDQGFYNGPVSKFWAYAFVLSKAPELGDTIFIILRKQKLIFLHWYHHITVLL | |
| 100 μL | |
| metabolism | |
| 79071 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
| ELISA, Western Blot | |
| Unconjugated | |
| PBS (pH 7.3), 50% glycerol | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Human, Mouse, Rat | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Haben Sie Verbesserungsvorschläge?Übermitteln Sie eine inhaltliche Korrektur