missing translation for 'onlineSavingsMsg'
Learn More
Learn More
EMID2 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP1-62711
Dieser Artikel kann nicht zurückgegeben werden.
Rückgaberichtlinie anzeigen
Beschreibung
EMID2 Polyclonal antibody specifically detects EMID2 in Human samples. It is validated for Western Blot
Spezifikation
| EMID2 | |
| Polyclonal | |
| Unconjugated | |
| PBS, 2% Sucrose | |
| COL26A1, EMI domain containing 2, EMI domain-containing protein 2, Emilin and multimerin domain-containing protein 2, emilin and multimerin-domain containing protein 2, EMU2, Emu2type XXVI, alpha 1, hEmu2, KIAA1299, MGC129848, putative emu2, SH2B, SH2B1 | |
| Synthetic peptides corresponding to EMID2(EMI domain containing 2) The peptide sequence was selected form the C terminal of EMID2. Peptide sequence GVQQLREALKILAERVLILEHMIGIHDPLASPEGGSGQDAALRANLKMKR. The peptide sequence for this immunogen was taken from within the described region. | |
| 100 μg | |
| Primary | |
| Human | |
| Purified |
| Western Blot | |
| 0.5 mg/mL | |
| Western Blot 1.0 μg/mL | |
| Q96A83 | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| 136227 | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. | |
| IgG |
Berichtigung von Produktinhalten
Bitte geben Sie uns Ihr Feedback zu den Produktinhalten, indem Sie das folgende Formular ausfüllen.
Name des Produkts
Haben Sie Verbesserungsvorschläge?Übermitteln Sie eine inhaltliche Korrektur