missing translation for 'onlineSavingsMsg'
Learn More

EMR4P Antibody (1G10), Novus Biologicals™

Mouse Monoclonal Antibody

Brand: Novus Biologicals H00326342-M02

Product Code. 18570734

€ 589.00 / 0.10mg

Please sign in to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

EMR4P Monoclonal antibody specifically detects EMR4P in Human samples. It is validated for Western Blot, ELISA, Immunocytochemistry/ Immunofluorescence

Specifications

Antigen	EMR4P
Classification	Monoclonal
Conjugate	Unconjugated
Gene Alias	egf-like module containing, mucin-like, hormone receptor-like 4, egf-like module containing, mucin-like, hormone receptor-like 4 pseudogene, EMR4EGF-like module receptor 4, FIRE, GPR127G-protein coupled receptor 127, G-protein coupled receptor PGR16, PGR16G protein-coupled receptor 127
Immunogen	EMR4P (XP_377506, 21 a.a. ∽ 93 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. GSEAKNSGASCPPCPKYASCHNSTHCTCEDGFRARSGRTYFHDSSEKCEDINECETGLAKCKYKAYCRNKVGG
Quantity	0.1 mg
Research Discipline	GPCR, Neuroscience
Gene ID (Entrez)	326342
Content And Storage	Aliquot and store at -20°C or -80°C. Avoid freeze-thaw cycles.
Isotype	IgG2a κ

Applications	Western Blot, ELISA, Immunocytochemistry/Immunofluorescence
Clone	1G10
Formulation	In 1x PBS, pH 7.4
Host Species	Mouse
Purification Method	IgG purified
Regulatory Status	RUO
Primary or Secondary	Primary
Target Species	Human
Form	Purified

Product Suggestions

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

Your Name

Email Address *

Type of Issue *

Detailed Description of Issue/Request *

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.

Spot an opportunity for improvement?Share a Content Correction

EMR4P Antibody (1G10), Novus Biologicals™

Description

Specifications

Product Suggestions

Documents

Promotions