missing translation for 'onlineSavingsMsg'
Learn More

Enteropeptidase/Enterokinase Antibody, Novus Biologicals™

Product Code. 18676046 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
100 μg
25 μL
Unit Size:
100µL
25µL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18676046 25 μL 25µL
18628728 100 μg 100µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
This item is not returnable. View return policy
Product Code. 18676046 Supplier Novus Biologicals Supplier No. NBP26267925ul

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Rabbit Polyclonal Antibody

Enteropeptidase/Enterokinase Polyclonal antibody specifically detects Enteropeptidase/Enterokinase in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)
TRUSTED_SUSTAINABILITY

Specifications

Antigen Enteropeptidase/Enterokinase
Applications Immunohistochemistry, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugate Unconjugated
Dilution Immunohistochemistry 1:500 - 1:1000, Immunohistochemistry-Paraffin 1:500 - 1:1000
Formulation PBS (pH 7.2) and 40% Glycerol
Gene Alias EC 3.4.21, EC 3.4.21.9, Enterokinase, ENTKenterokinase, MGC133046, protease, serine, 7 (enterokinase), PRSS7enteropeptidase, Serine protease 7, Transmembrane protease serine 15, transmembrane protease, serine 15
Host Species Rabbit
Immunogen This antibody was developed against a recombinant protein corresponding to amino acids: LNDDNEWERIQGSTFSPFTGPNFDHTFGNASGFYISTPTGPGGRQERVGLLSLPLDPTLEPACLSFWYHMYGENVHKLSINISNDQNMEK
Purification Method Protein A purified
Quantity 25 μL
Regulatory Status RUO
Research Discipline Epitope Tags, Immunology, Innate Immunity
Primary or Secondary Primary
Gene ID (Entrez) 5651
Target Species Human
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.