missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Epimorphin/Syntaxin 2 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-55283
This item is not returnable.
View return policy
Description
Epimorphin/Syntaxin 2 Polyclonal specifically detects Epimorphin/Syntaxin 2 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.
Specifications
| Epimorphin/Syntaxin 2 | |
| Polyclonal | |
| Immunocytochemistry/Immunofluorescence 1-4 ug/ml | |
| EPIMepimorphin, EPM, STX2AMGC51014, STX2Bsyntaxin-2, STX2CEpimorphin, syntaxin 2 | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
| STX2 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:DRLPDLTACRKNDDGDTVVVVEKDHFMDDFFHQVEEIRNTIDKITQYVEEVKK | |
| 100 μL | |
| Neuroscience | |
| 2054 | |
| Human | |
| IgG |
Berichtigung von Produktinhalten
Bitte geben Sie uns Ihr Feedback zu den Produktinhalten, indem Sie das folgende Formular ausfüllen.
Name des Produkts
For Research Use Only
Haben Sie Verbesserungsvorschläge?Übermitteln Sie eine inhaltliche Korrektur