missing translation for 'onlineSavingsMsg'
Få mere at vide
Få mere at vide
ER alpha/NR3A1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody has been used in 1 publication
€ 316.00 - € 456.00
Tekniske data
| Antigen | ER alpha/NR3A1 |
|---|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Produktkode | Brand | Quantity | Pris | Mængde & tilgængelighed | |||||
|---|---|---|---|---|---|---|---|---|---|
| Produktkode | Brand | Quantity | Pris | Mængde & tilgængelighed | |||||
|
18420201
|
Novus Biologicals
NBP1-84826-25ul |
25ul |
€ 316.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18269487
|
Novus Biologicals
NBP1-84826 |
0.1 mL |
€ 456.00
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Beskrivelse
ER alpha/NR3A1 Polyclonal specifically detects ER alpha/NR3A1 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.Tekniske data
| ER alpha/NR3A1 | |
| Polyclonal | |
| Rabbit | |
| Angiogenesis, Breast Cancer, Cancer, Cell Biology, Cell Cycle and Replication, Dendritic Cell Markers, GPCR, Neuroscience, Signal Transduction, Transcription Factors and Regulators | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| ER, ER alpha, Era, ER-alpha, ESRESRA, Estradiol receptor, estrogen receptor, estrogen receptor 1, estrogen receptor alpha, estrogen receptor alpha delta 3*4,56,7*/819-2 isoform, estrogen receptor alpha delta 4 +49 isoform, estrogen receptor alpha delta 4*5,6,7*/654 isoform, NR3A1DKFZp686N23123, Nuclear receptor subfamily 3 group A member 1 | |
| ESR1 | |
| IgG | |
| Affinity Purified | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| Human | |
| P03372 | |
| 2099 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:LQGEEFVCLKSIILLNSGVYTFLSSTLKSLEEKDHIHRVLDKITDTLIHLMAKAGLTLQQQHQRLAQLLLILSHIRHMSNKGMEHLYSMKCKNVVPLYDLLLEMLDAHRLHAPTSRGGASVEETDQSHLATAGSTSSHSLQKYYIT | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title