missing translation for 'onlineSavingsMsg'
Learn More
Learn More
ER Membrane Protein Complex Subunit 10 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-30611
This item is not returnable.
View return policy
Description
ER Membrane Protein Complex Subunit 10 Polyclonal specifically detects ER Membrane Protein Complex Subunit 10 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.
Specifications
| ER Membrane Protein Complex Subunit 10 | |
| Polyclonal | |
| Western Blot 0.04 - 0.4 ug/ml, Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200 | |
| Q5UCC4 | |
| EMC10 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: DQLTLHVDVAGNVVGVSVVTHPGGCRGHEVEDVDLELFNTSVQLQPPTTAPGPETAAFIERLEMEQAQKAKN | |
| 0.1 mL | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| C19orf63, Chromosome 19 Open Reading Frame 63, EMC10, Hematopoietic Signal Peptide-Containing Membrane Domain-Containing 1, Hematopoietic Signal Peptide-Containing Membrane Domain-Containing Protein 1, Hematopoietic Signal Peptide-Containing Secreted 1, HSM1, HSS1, INM02, UPF0510 Protein INM02 | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| 284361 | |
| Human | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction