missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Novus Biologicals™ ERK1 Inhibitor Peptide Set
Shop All Bio Techne Products
Click to view available options
Quantity:
2 mg
5 mg
Unit Size:
2mg
5mg
Specifications
Specifications
| Host Species | Human, Mouse, Rat, Hamster, Rabbit, Xenopus |
| Components | ERK Inhibitor peptide: 2 x 1mg (lyophilized) DRQIKIWFQNRRMKWKKGMPKKKPTPIQLN (ERK inhibitor sequence: GMPKKKPTPIQLN). Molecular weight: 3795. Antennapedia Control peptide: 2 x 1mg (lyophilized) DRQIKIWFQNRRMKWKK. Molecular weight: 2361 |
| For Use With (Application) | Inhibition of Erk activation |
| Content And Storage | Aliquot and store at -20°C or -80°C. Avoid freeze-thaw cycles. |
| Quantity | 5 mg |
| Product Type | ERK1 Inhibitor Peptide Set |
| Molecular Weight (g/mol) | 3795 |
| Inhibitors | ERK1 |
| Form | Lyophilized |
For Research Use Only
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction