missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Custom Products and Services
  4. Custom Enzymes and Inhibitors
  5. Novus Biologicals™ ERK1 Inhibitor Peptide Set

Novus Biologicals™ ERK1 Inhibitor Peptide Set

Product Code. 18116222 Shop All Bio Techne Products
Click to view available options
Quantity:
2 mg
5 mg
Unit Size:
2mg
5mg
This item is not returnable. View return policy

Product Code. 18116222

Brand: Novus Biologicals™ NBP229333

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

For use in research applications

TRUSTED_SUSTAINABILITY

Specifications

Host Species Human, Mouse, Rat, Hamster, Rabbit, Xenopus
Components ERK Inhibitor peptide: 2 x 1mg (lyophilized) DRQIKIWFQNRRMKWKKGMPKKKPTPIQLN (ERK inhibitor sequence: GMPKKKPTPIQLN). Molecular weight: 3795. Antennapedia Control peptide: 2 x 1mg (lyophilized) DRQIKIWFQNRRMKWKK. Molecular weight: 2361
For Use With (Application) Inhibition of Erk activation
Content And Storage Aliquot and store at -20°C or -80°C. Avoid freeze-thaw cycles.
Quantity 2 mg
Product Type ERK1 Inhibitor Peptide Set
Molecular Weight (g/mol) 3795
Inhibitors ERK1
Form Lyophilized

For Research Use Only

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.