missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Exosome component 5 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
€ 280.00 - € 624.00
Specifications
| Antigen | Exosome component 5 |
|---|---|
| Applications | Immunocytochemistry, Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18223164
|
Novus Biologicals
NBP2-56887 |
100 μL |
€ 624.00
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18655387
|
Novus Biologicals
NBP2-56887-25ul |
25 μL |
€ 280.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
Exosome component 5 Polyclonal specifically detects Exosome component 5 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.Specifications
| Exosome component 5 | |
| Polyclonal | |
| Rabbit | |
| DNA replication Transcription Translation and Splicing, Epigenetics | |
| PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
| 56915 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:MEEETHTDAKIRAENGTGSSPRGPGCSLRHFACEQNLLSRPDGSASFLQGDTSVLAGVYGPAEVKVSKEI | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| RUO | |
| Human | |
| CML28, exosome complex exonuclease RRP46, exosome component 5Chronic myelogenous leukemia tumor antigen 28, exosome component Rrp46, hRrp46p, MGC12901, p12BMGC111224, RRP41B, Rrp46p, RRP46Ribosomal RNA-processing protein 46 | |
| EXOSC5 | |
| IgG | |
| Affinity Purified |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title