missing translation for 'onlineSavingsMsg'
Learn More
Learn More
EZH1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-69048
This item is not returnable.
View return policy
Description
EZH1 Polyclonal antibody specifically detects EZH1 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)
Specifications
| EZH1 | |
| Polyclonal | |
| Immunohistochemistry 1:2500 - 1:5000, Immunohistochemistry-Paraffin 1:2500 - 1:5000 | |
| EC 2.1.1.43, Enhancer of zeste homolog 1, enhancer of zeste homolog 1 (Drosophila), ENX-2, histone-lysine N-methyltransferase EZH1, KIAA0388enhancer of zeste (Drosophila) homolog 1, KMT6B | |
| This antibody was developed against a recombinant protein corresponding to amino acids: YKRKNKEIKIEPEPCGTDCFLLLEGAKEYAMLHNPRSKCSGRRRRRHHIVSASCSNASASAVAETKEGDSDRDTGNDWASSSSE | |
| 100 μg | |
| Chromatin Research | |
| 2145 | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. | |
| IgG |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol | |
| Rabbit | |
| Protein A purified | |
| RUO | |
| Primary | |
| Human | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction