missing translation for 'onlineSavingsMsg'
Learn More
Learn More
FAM101B Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-62633
This item is not returnable.
View return policy
Description
FAM101B Polyclonal antibody specifically detects FAM101B in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)
Specifications
| FAM101B | |
| Polyclonal | |
| Immunohistochemistry 1:20 - 1:50, Immunohistochemistry-Paraffin 1:20 - 1:50 | |
| CFM1, FAM101B, Family With Sequence Similarity 101, Member B, Filamin-Interacting Protein FAM101B, Protein FAM101B, Refilin B, RefilinB, Refilin-B, Regulator Of Filamin Protein B, RFLNB | |
| This antibody was developed against a recombinant protein corresponding to amino acids: EGVEFDPLPPKEVRYTSLVKYDSERHFIDDVQLPLGLAVASCSQTVTCVP | |
| 100 μg | |
| Primary | |
| Human | |
| Purified |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol | |
| Rabbit | |
| Protein A purified | |
| RUO | |
| 359845 | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction