missing translation for 'onlineSavingsMsg'
Learn More
Learn More
FAM120A Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
€ 292.00 - € 572.00
Specifications
| Antigen | FAM120A |
|---|---|
| Dilution | Western Blot 0.4 ug/ml, Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:50 - 1:200 |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18471441
|
Novus Biologicals
NBP1-86715-25ul |
25 μL |
€ 292.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18288397
|
Novus Biologicals
NBP1-86715 |
0.1 mL |
€ 572.00
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
FAM120A Polyclonal specifically detects FAM120A in Human, Mouse, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.Specifications
| FAM120A | |
| Polyclonal | |
| Rabbit | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| 23196 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:SGGATNHISGNKIGWEKTGSHSEPQARGDPGDQTKAEGSSTASSGSQLAEGKGSQMGTVQPIPCLLSMPTRNHMDITTPPL | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Western Blot 0.4 ug/ml, Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:50 - 1:200 | |
| Unconjugated | |
| RUO | |
| C9orf10MGC133257, chromosome 9 open reading frame 10, constitutive coactivator of PPAR-gamma-like protein 1, DNA polymerase-transactivated protein 1, DNA polymerase-transactivated protein 5, DNAPTP1, DNAPTP5, family with sequence similarity 120A, KIAA0183MGC111527, OSSA, Oxidative stress-associated Src activator, Protein FAM120A | |
| FAM120A | |
| IgG | |
| Affinity Purified | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title