missing translation for 'onlineSavingsMsg'
Learn More
Learn More
FAM177A1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-33294
This item is not returnable.
View return policy
Description
FAM177A1 Polyclonal specifically detects FAM177A1 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.
Specifications
| FAM177A1 | |
| Polyclonal | |
| Western Blot 0.4 ug/ml, Immunohistochemistry, Immunohistochemistry-Paraffin 1:200 - 1:500 | |
| Q8N128 | |
| FAM177A1 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: ESAGQMSNERGFENVELGVIGKKKKVPRRVIHFVSGETMEEYSTDEDEVDGVEKKDV | |
| 0.1 mL | |
| Protein Phosphatase | |
| 283635 | |
| Human | |
| IgG |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| C14orf24, chromosome 14 open reading frame 24, DKFZp686J1254, family with sequence similarity 177, member A1, FLJ38854, hypothetical protein LOC283635 | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction