missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Biochemical Reagents
  4. Peptides
  5. 18125088

Novus Biologicals™ FAM177B Recombinant Protein Antigen

Product Code. 18125088 Shop All Bio Techne Products
Click to view available options
Quantity:
0.1 mL
Unit Size:
0.10mL
This item is not returnable. View return policy

Product Code. 18125088

Brand: Novus Biologicals™ NBP238015PEP

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Highly purified. Generating reliable and reproducible results. Applications: Antibody Competition

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human FAM177B. The FAM177B Recombinant Protein Antigen is derived from E. coli. The FAM177B Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.

This is a blocking peptide for NBP2-38015. This is a human recombinant protein expressed in E. coli with a N-terminal His-ABP tag and purified with IMAC chromatography.

TRUSTED_SUSTAINABILITY

Specifications

Gene ID (Entrez) 400823
Species Human
Purification Method Chromatography
Purity >80%
Concentration 0.5mg/mL
Content And Storage Store at -20°C. Avoid freeze-thaw cycles.
Formulation PBS and 1M Urea, pH 7.4.
For Use With (Application) Blocking/Neutralizing, Control
Gene Symbol FAM177B
Label Type Unlabeled
Molecular Weight (g/mol) 25kDa
Product Type FAM177B
Quantity 0.1 mL
Regulatory Status RUO
Source E.Coli
Specific Reactivity This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-38015. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Immunogen TQPKYQYVLNEFYRIQNKKSDNKSERRGSKAQAAEVPNEKCHLEAGVREYGTIQQDVTEAIPQ
Vedi altri risultati Mostra meno risultati

For Research Use Only

Correzione del contenuto del prodotto

Fornite il vostro feedback sul contenuto del prodotto compilando il modulo sottostante.

Titolo del prodotto

Facendo clic su Invia, l'utente riconosce che potrebbe essere contattato da Fisher Scientific in merito al feedback fornito in questo modulo. Non condivideremo le vostre informazioni per altri scopi. Tutte le informazioni di contatto fornite saranno conservate in conformità con la nostra Politica sulla privacy. Informativa sulla privacy.

Grazie per averci aiutato a migliorare il nostro sito web. Il vostro feedback è stato inviato