missing translation for 'onlineSavingsMsg'
Learn More
Learn More
FAM20C Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
€ 483.00
Specifications
| Antigen | FAM20C |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
FAM20C Polyclonal specifically detects FAM20C in Human samples. It is validated for Western Blot.Specifications
| FAM20C | |
| Polyclonal | |
| Rabbit | |
| dentin matrix protein 4, DKFZp547C074, DMP4, DMP-4, family with sequence similarity 20, member C, RNS | |
| FAM20C | |
| IgG |
| Western Blot | |
| Unconjugated | |
| RUO | |
| 56975 | |
| Synthetic peptides corresponding to FAM20C(family with sequence similarity 20, member C) The peptide sequence was selected from the C terminal of FAM20C. Peptide sequence NETFIIHLDNGRGFGKYSHDELSILVPLQQCCRIRKSTYLRLQLLAKEEY. | |
| Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title