missing translation for 'onlineSavingsMsg'
Learn More
Learn More
FAM211A Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
€ 280.00 - € 539.00
Specifications
| Antigen | FAM211A |
|---|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin), Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18441361
|
Novus Biologicals
NBP1-93828-25ul |
25 μL |
€ 280.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18055047
|
Novus Biologicals
NBP1-93828 |
0.1 mL |
€ 539.00
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
FAM211A Polyclonal specifically detects FAM211A in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
| FAM211A | |
| Polyclonal | |
| Rabbit | |
| Human | |
| C17orf76, chromosome 17 open reading frame 76, FLJ35696, leucine-rich repeat-containing protein C17orf76 | |
| FAM211A | |
| IgG | |
| Affinity Purified | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin), Immunofluorescence | |
| Unconjugated | |
| RUO | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| 388341 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:GMVQELLRMVRQGRREEAGTLLQHLRQDLGMESTSLDDVLYRYASFRNLVDPITHDLIISLARYIHCPKP | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title