missing translation for 'onlineSavingsMsg'
Learn More
Learn More
FAM46D Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-32454-25ul
Denne vare kan ikke returneres.
Se returpolicy
Beskrivelse
FAM46D Polyclonal specifically detects FAM46D in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.
Tekniske data
| FAM46D | |
| Polyclonal | |
| Immunohistochemistry, Immunohistochemistry-Paraffin 1:20 - 1:50 | |
| cancer/testis antigen 112, CT1.26, CT112, family with sequence similarity 46, member D, hypothetical protein LOC169966, MGC26999 | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| 169966 | |
| Human | |
| IgG |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| FAM46D | |
| This antibody was developed against a recombinant protein corresponding to amino acids: PTMEVKPKDIIHVVKDQLIGQGIIVKDARLNGSVASYILASHNGISYKDLDVIFGVELPGNEEFQV | |
| 25 μL | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Korrektion af produktindhold
Dit input er vigtigt for os. Udfyld denne formular for at give feedback relateret til indholdet på dette produkt.
Produkttitel
For Research Use Only
Ser du en mulighed for forbedring?Del en indholdskorrektion