missing translation for 'onlineSavingsMsg'
Learn More
Learn More
FATP3/SLC27A3 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
€ 415.00 - € 624.00
Specifications
| Antigen | FATP3/SLC27A3 |
|---|---|
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Regulatory Status | RUO |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18267254
|
Novus Biologicals
NBP2-57049 |
100 μL |
€ 624.00
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18613887
|
Novus Biologicals
NBP2-57049-25ul |
25 μL |
€ 415.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
FATP3/SLC27A3 Polyclonal specifically detects FATP3/SLC27A3 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.Specifications
| FATP3/SLC27A3 | |
| Unconjugated | |
| RUO | |
| PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
| 11000 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:DTWERFVRRFGPLQVLETYGLTEGNVATINYTGQRGAVGRASWLYKHIFPFSLIRYDVTTGEPIRDPQGHCMATSPGEPGLLVAPVSQQSPFLGYAGGPELAQGKLLKDVFR | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Polyclonal | |
| Rabbit | |
| Human | |
| EC 6.2.1, EC 6.2.1.-, EC 6.2.1.7, FATP-3, FATP3ACSVL3MGC4365, Fatty acid transport protein 3, long-chain fatty acid transport protein 3, solute carrier family 27 (fatty acid transporter), member 3, Solute carrier family 27 member 3, Very long-chain acyl-CoA synthetase homolog 3, VLCS-3 | |
| SLC27A3 | |
| IgG | |
| Affinity Purified |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title