missing translation for 'onlineSavingsMsg'
Learn More
Learn More
FBXW11 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
€ 201.60 - € 552.30
Specifications
| Antigen | FBXW11 |
|---|---|
| Dilution | Western Blot 1:500 - 1:1000, ELISA, Immunocytochemistry/Immunofluorescence 1:50 - 1:200 |
| Applications | ELISA, Western Blot, Immunocytochemistry/Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
30228251
|
Novus Biologicals
NBP3-38464-20ul |
20 μL |
€ 214.00 € 201.60 / 20µL Save € 12.40 5% Off |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
30230453
|
Novus Biologicals
NBP3-38464-100ul |
100 μL |
€ 584.00 € 552.30 / 100µL Save € 31.70 5% Off |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
FBXW11 Polyclonal antibody specifically detects FBXW11 in Human,Mouse,Rat samples. It is validated for ELISA,Western Blot,Immunocytochemistry/ImmunofluorescenceSpecifications
| FBXW11 | |
| ELISA, Western Blot, Immunocytochemistry/Immunofluorescence | |
| Unconjugated | |
| Rabbit | |
| Signal Transduction, Wnt Signaling Pathway | |
| PBS (pH 7.3), 50% glycerol | |
| 23291 | |
| IgG | |
| Affinity purified |
| Western Blot 1:500 - 1:1000, ELISA, Immunocytochemistry/Immunofluorescence 1:50 - 1:200 | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human, Mouse, Rat | |
| beta-transducin repeat-containing protein 2, BTRC2F-box/WD repeat-containing protein 1B, BTRCP2FBW1B, F-box and WD repeat domain containing 11, F-box and WD-40 domain protein 11, F-box and WD-40 domain protein 1B, F-box protein Fbw1b, F-box/WD repeat-containing protein 11, Fbw11, FBXW1BFbw1b, Homologous to Slimb protein, Hos, KIAA0696F-box and WD repeats protein beta-TrCP2 | |
| A synthetic peptide corresponding to a sequence within amino acids 443-542 of human FBXW11 (NP_036432.2).,, Sequence:, MEPDSVIEDKTIELMCSVPRSLWLGCANLVESMCALSCLQSMPSVRCLQISNGTSSVIVSRKRPSEGNYQKEKDLCIKYFDQWSE | |
| Primary | |
| Store at -20°C. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title