missing translation for 'onlineSavingsMsg'
Learn More
Learn More
FBXW12 Antibody (1A9), Novus Biologicals™
Mouse Monoclonal Antibody
Brand: Novus Biologicals H00285231-M03
This item is not returnable.
View return policy
Description
FBXW12 Monoclonal antibody specifically detects FBXW12 in Human samples. It is validated for Western Blot, ELISA, Sandwich ELISA
Specifications
| FBXW12 | |
| Monoclonal | |
| Unconjugated | |
| NP_996985 | |
| Mouse | |
| Protein A purified | |
| RUO | |
| 285231 | |
| Aliquot and store at -20°C or -80°C. Avoid freeze-thaw cycles. | |
| IgG2a κ |
| Western Blot, ELISA, Sandwich ELISA | |
| 1A9 | |
| In 1x PBS, pH 7.4 | |
| F-box and WD repeat domain containing 12, F-box and WD-40 domain-containing protein 12, F-box- and WD40-repeat-containing protein, F-box only protein 35MGC120386, F-box/WD repeat-containing protein 12, Fbw12, FBW12MGC120387, FBXO12FBXO35F-box and WD-40 domain protein 12, MGC120385 | |
| FBXW12 (NP_996985.1, 265 a.a. ∽ 354 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. LLRPSEGSDPLSTFLPHKLCASACWTPKVKNRITLMSQSSTGKKTEFITFDLTTKKTGGQTVIQAYEIASFQVAAHLKCPIWMGASDGYM | |
| 0.1 mg | |
| Primary | |
| Human | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction