missing translation for 'onlineSavingsMsg'
Learn More
Learn More
FE65 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-48682
This item is not returnable.
View return policy
Description
FE65 Polyclonal antibody specifically detects FE65 in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/ Immunofluorescence, Immunohistochemistry (Paraffin)
Specifications
| FE65 | |
| Polyclonal | |
| Immunohistochemistry 1:200 - 1:500, Immunocytochemistry/ Immunofluorescence 0.25-2 μg/mL, Immunohistochemistry-Paraffin 1:200 - 1:500 | |
| adaptor protein FE65a2, amyloid beta (A4) precursor protein-binding, family B, member 1 (Fe65), amyloid beta A4 precursor protein-binding, family B, member 1, Fe65, FE65amyloid beta A4 precursor protein-binding family B member 1, MGC:9072, Protein Fe65, RIR, stat-like protein | |
| This antibody was developed against a recombinant protein corresponding to amino acids: QEESQLTWTGFAHGEGFEDGEFWKDEPSDEAPMELGLKEPEEGTLTFPAQSLSPEPLPQEEEKLPPRNTNPGI | |
| 0.1 mL | |
| Alzheimers Research, Cell Cycle and Replication, Neurodegeneration, Neuroscience, Signal Transduction | |
| 322 | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. | |
| IgG |
| Immunohistochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2), 40% Glycerol | |
| Rabbit | |
| Immunogen affinity purified | |
| RUO | |
| Primary | |
| Human | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction