missing translation for 'onlineSavingsMsg'
Learn More
Learn More
FGF-4 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP1-83291-25ul
This item is not returnable.
View return policy
Description
FGF-4 Polyclonal specifically detects FGF-4 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.
Specifications
| FGF-4 | |
| Polyclonal | |
| Western Blot 0.4 ug/ml, Immunohistochemistry, Immunohistochemistry-Paraffin 1:20 - 1:50 | |
| fibroblast growth factor 4, HBGF-4Transforming protein KS3, heparin secretory transforming protein 1, Heparin secretory-transforming protein 1, Heparin-binding growth factor 4, HST-1HSTF-1, HSTF1fibroblast growth factor 4 splice isoform, HSTFGF-4, human stomach cancer, transforming factor from FGF-related oncogene, kaposi sarcoma oncogene, KFGF, K-FGF, KS3, oncogene HST | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| FGF4 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:VVSIFGVASRFFVAMSSKGKLYGSPFFTDECTFKEILLPNNYNAYESYKYPGMFIALSKNGKTKKGNRVSPTMKVTHFL | |
| 25 μL | |
| Angiogenesis, Cancer | |
| 2249 | |
| Human | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction