missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 16334665

Invitrogen™ FIBB Polyclonal Antibody
GREENER_CHOICE

Product Code. 16334665 Shop All Thermo Scientific Products
Change view
Click to view available options
Quantity:
100 μg
Unit Size:
100µg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
16334665 100 μg 100µg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 16334665 Supplier Invitrogen™ Supplier No. PA595396

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Rabbit Polyclonal Antibody

Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 μg/mL. Positive Control - WB: human HepG2 whole cell, rat kidney tissue, rat liver tissue, mouse kidney tissue, mouse liver tissue. ICC/IF: A549 cell. Flow: HepG2 cell. Store at -20°C for one year from date of receipt. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for six months. Avoid repeated freeze-thaw cycles.

FIBB is the beta component of fibrinogen, a blood-borne glycoprotein comprised of three pairs of nonidentical polypeptide chains. Following vascular injury, fibrinogen is cleaved by thrombin to form fibrin which is the most abundant component of blood clots. In addition, various cleavage products of fibrinogen and fibrin regulate cell adhesion and spreading, display vasoconstrictor and chemotactic activities, and are mitogens for several cell types. Mutations in its gene lead to several disorders, including afibrinogenemia, dysfibrinogenemia, hypodysfibrinogenemia and thrombotic tendency.
TRUSTED_SUSTAINABILITY

Specifications

Antigen FIBB
Applications Flow Cytometry, Western Blot, Immunocytochemistry
Classification Polyclonal
Concentration 500 μg/mL
Conjugate Unconjugated
Formulation PBS with 4mg trehalose and no preservative
Gene Fgb
Gene Accession No. P02675, P14480, Q8K0E8
Gene Alias 2510049G14Rik; Ab1-181; Ab1-216; Ac1-581; B beta polypeptide; beta-fibrinogen; epididymis secretory sperm binding protein Li 78p; Fgb; fibrinogen; Fibrinogen beta chain; fibrinogen, B beta polypeptide; fibrinogen, beta polypeptide; Fibrinopeptide B; HEL-S-78p; Liver regeneration-related protein LRRG036/LRRG043/LRRG189; MGC104327; MGC120405
Gene Symbols Fgb
Host Species Rabbit
Immunogen A synthetic peptide corresponding to a sequence in the middle region of human FGB (193-225aa TNLRVLRSILENLRSKIQKLESDVSAQMEYCRT).
Purification Method Affinity chromatography
Quantity 100 μg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 110135, 2244, 24366
Target Species Human, Mouse, Rat
Content And Storage -20°C
Product Type Antibody
Form Lyophilized
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.