missing translation for 'onlineSavingsMsg'
Learn More
Learn More
FNTA Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
€ 433.00
Specifications
| Antigen | FNTA |
|---|---|
| Dilution | Western Blot 0.4 μg/mL, Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1-4 μg/mL, Immunohistochemistry-Paraffin 1:500-1:1000 |
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
Description
FNTA Polyclonal specifically detects FNTA in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.Specifications
| FNTA | |
| Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| Human | |
| CAAX farnesyltransferase subunit alpha, EC 2.5.1.58, EC 2.5.1.59, farnesyl-protein transferase alpha-subunit, farnesyltransferase, CAAX box, alpha, FPTA, FTase-alpha, GGTase-I-alpha, MGC99680, PGGT1A, protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha, protein prenyltransferase alpha subunit repeat containing 2, PTAR2, Ras proteins prenyltransferase subunit alpha, type I protein geranyl-geranyltransferase alpha subunit, Type I protein geranyl-geranyltransferase subunit alpha | |
| FNTA | |
| IgG | |
| Affinity Purified | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Western Blot 0.4 μg/mL, Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1-4 μg/mL, Immunohistochemistry-Paraffin 1:500-1:1000 | |
| Polyclonal | |
| Rabbit | |
| Signal Transduction | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| 2339 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:LDSPSYVLYRHFRRVLLKSLQKDLHEEMNYITAIIEEQPKNYQVWHHRRVLVEWLRDPSQELEFIADI | |
| Primary | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title