missing translation for 'onlineSavingsMsg'
Learn More
Learn More
FUBP1 Antibody, Novus Biologicals™
Rabbit Monoclonal Antibody
Brand: Novus Biologicals NBP3-33539-100ul
This item is not returnable.
View return policy
Description
FUBP1 Monoclonal antibody specifically detects FUBP1 in Human,Mouse,Rat samples. It is validated for ELISA,Immunohistochemistry,Western Blot,Immunohistochemistry (Paraffin),Immunocytochemistry/Immunofluorescence
Specifications
| FUBP1 | |
| Monoclonal | |
| Western Blot 1:500 - 1:1000, ELISA Recommended starting concentration is 1 μg/mL, Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1:100 - 1:500, Immunohistochemistry-Paraffin 1:50 - 1:200 | |
| far upstream element (FUSE) binding protein 1, far upstream element binding protein, far upstream element-binding protein 1, FBPDNA helicase V, FUBP, FUSE-binding protein 1, hDH V | |
| A synthetic peptide corresponding to a sequence within amino acids 545-644 of human FUBP1 (Q96AE4).,, Sequence:, YQQQAQPPPAAPAGAPTTTQTNGQGDQQNPAPAGQVDYTKAWEEYYKKMGQAVPAPTGAPPGGQPDYSAAWAEYYRQQAAYYAQTSPQGMPQHPPAPQGQ | |
| 100 μL | |
| DNA replication Transcription Translation and Splicing | |
| 8880 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
| ELISA, Immunohistochemistry, Western Blot, Immunohistochemistry (Paraffin), Immunocytochemistry/Immunofluorescence | |
| Unconjugated | |
| PBS (pH 7.3), 50% glycerol, 0.05% BSA | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Human, Mouse, Rat | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction