missing translation for 'onlineSavingsMsg'
Learn More
Learn More
FUSIP1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
€ 415.00 - € 624.00
Specifications
| Antigen | FUSIP1 |
|---|---|
| Dilution | Immunohistochemistry 1:50 - 1:200, Immunocytochemistry/ Immunofluorescence 0.25-2 μg/mL, Immunohistochemistry-Paraffin 1:50 - 1:200 |
| Applications | Immunohistochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18648765
|
Novus Biologicals
NBP2-46818-25ul |
25 μL |
€ 415.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18615845
|
Novus Biologicals
NBP2-46818 |
0.1 mL |
€ 624.00
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
FUSIP1 Polyclonal antibody specifically detects FUSIP1 in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/ Immunofluorescence, Immunohistochemistry (Paraffin)Specifications
| FUSIP1 | |
| Immunohistochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| Rabbit | |
| Core ESC Like Genes, Stem Cell Markers | |
| PBS (pH 7.2), 40% Glycerol | |
| 40 kDa SR-repressor protein, FLJ43846, FUS interacting protein (serine-arginine rich) 1, FUS-interacting protein (serine-arginine rich) 2, FUS-interacting serine-arginine-rich protein 1, FUSIP1DKFZp686H0644, FUSIP2, neural-salient SR protein, NSSR, serine/arginine-rich splicing factor 10, serine-arginine repressor protein (40 kDa), SFRS13, SFRS13A, Splicing factor SRp38, splicing factor, arginine/serine-rich 13, Splicing factor, arginine/serine-rich 13ATLS-associated protein with Ser-Arg repeats, SR splicing factor 10, SRp38, SRrp40TLS-associated protein with SR repeats, TASR1TLS-associated SR protein, TASR2FUS interacting protein (serine/arginine-rich) 1, TASRFLJ30749, TLS-associated protein TASR, TLS-associated serine-arginine protein, TLS-associated serine-arginine protein 1, TLS-associated serine-arginine protein 2 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids: QPKKEMKAKSRSRSASHTKTRGTSKTDSKTHYKSGSRYEKESRKKEPPRSKSQS | |
| Primary | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
| Immunohistochemistry 1:50 - 1:200, Immunocytochemistry/ Immunofluorescence 0.25-2 μg/mL, Immunohistochemistry-Paraffin 1:50 - 1:200 | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human | |
| O75494 | |
| 10772 | |
| IgG | |
| Immunogen affinity purified |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title