missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 15887533

Invitrogen™ FZD10 Polyclonal Antibody
GREENER_CHOICE

Product Code. 15887533
Change view
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
15887533 100 μL 100µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 15887533 Supplier Invitrogen™ Supplier No. PA569126

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Rabbit Polyclonal Antibody

This target displays homology in the following species: Cow: 92%; Dog: 92%; Horse: 92%; Human: 100%; Mouse: 92%; Pig: 100%.

FZD10/Frizzled-10 is a 581 amino acid protein belonging to the G-protein coupled receptor Fz/Smo family and containing a signal peptide, a cysteine-rich domain in the N-terminal, seven transmembrane domains and a C-terminal PDZ domain-binding motif. It is involved in transduction, intercellular transmission of polarity information during tissue morphogenesis in differentiated tissues and as a receptor for Wnt proteins. FZD10 is expressed highly in placenta, fetal kidney, fetal lung, brain cerebellum, cerebral cortex, medulla and spinal cord with very low levels in total brain, frontal lobe, temporal lobe, putamen, adult brain, heart, lung and skeletal muscle.
TRUSTED_SUSTAINABILITY

Specifications

Antigen FZD10
Applications Western Blot, Immunocytochemistry
Classification Polyclonal
Concentration 0.5 mg/mL
Conjugate Unconjugated
Formulation PBS with 2% sucrose and 0.09% sodium azide
Gene FZD10
Gene Accession No. Q9ULW2
Gene Alias CD350; CD350 antigen; frizzled 10, seven transmembrane spanning receptor; frizzled class receptor 10; frizzled family receptor 10; frizzled homolog 10; frizzled homolog 10 (Drosophila); frizzled homolog 10, pseudogene 1; frizzled-10; Fz10; Fz-10; Fzd10; Fzd10-ps1; FzE7; hFz10
Gene Symbols FZD10
Host Species Rabbit
Immunogen synthetic peptide directed towards the following sequence GMWIWTSKTLQSWQQVCSRRLKKKSRRKPASVITSGGIYKKAQHPQKTHH.
Purification Method Affinity chromatography
Quantity 100 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 11211
Target Species Human
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Product Type Antibody
Form Liquid
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.