missing translation for 'onlineSavingsMsg'
Learn More
Learn More
G protein alpha inhibitor 1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP3-38583-20ul
This item is not returnable.
View return policy
Description
G protein alpha inhibitor 1 Polyclonal antibody specifically detects G protein alpha inhibitor 1 in Human,Mouse,Rat samples. It is validated for ELISA,Western Blot
Specifications
| G protein alpha inhibitor 1 | |
| Polyclonal | |
| Western Blot 1:500 - 1:2000, ELISA | |
| Adenylate cyclase-inhibiting G alpha protein, Gi, Gi1 protein alpha subunit, guanine nucleotide binding protein (G protein), alpha inhibiting activitypolypeptide 1, guanine nucleotide-binding protein G(i) subunit alpha-1 | |
| A synthetic peptide corresponding to a sequence within amino acids 50-150 of human G protein alpha inhibitor 1 (NP_002060.4).,, Sequence:, VKQMKIIHEAGYSEEECKQYKAVVYSNTIQSIIAIIRAMGRLKIDFGDSARADDARQLFVLAGAAEEGFMTAELAGVIKRLWKDSGVQACFNRSREYQLND | |
| 20 μL | |
| Signal Transduction | |
| 2770 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
| ELISA, Western Blot | |
| Unconjugated | |
| PBS (pH 7.3), 50% glycerol | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Human, Mouse, Rat | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction