missing translation for 'onlineSavingsMsg'
Learn More
Learn More
GAB1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
€ 412.00 - € 742.00
Specifications
| Antigen | GAB1 |
|---|---|
| Dilution | Immunocytochemistry/ Immunofluorescence 0.25-2 μg/mL |
| Applications | Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18633799
|
Novus Biologicals
NBP3-05522-100ul |
100 μg |
€ 742.00
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18658278
|
Novus Biologicals
NBP3-05522-25ul |
25 μg |
€ 412.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
GAB1 Polyclonal antibody specifically detects GAB1 in Human samples. It is validated for Immunocytochemistry/ ImmunofluorescenceSpecifications
| GAB1 | |
| Immunofluorescence | |
| Unconjugated | |
| Rabbit | |
| Apoptosis, Signal Transduction, Tyrosine Kinases | |
| PBS, pH 7.2, containing 40% glycerol | |
| 2549 | |
| IgG | |
| Affinity purified |
| Immunocytochemistry/ Immunofluorescence 0.25-2 μg/mL | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human | |
| GRB2-associated binder 1, GRB2-associated binding protein 1, GRB2-associated-binding protein 1, Growth factor receptor bound protein 2-associated protein 1 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: TSKLDTIPDIPPPRPPKPHPAHDRSPVETCSIPRTASDTDSSYCIPTAGMSPSRSNTISTVDLNKLRKDASSQDCYDIPRAFP | |
| Primary | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title