missing translation for 'onlineSavingsMsg'
Learn More
Learn More
GABA-A R beta 1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
€ 415.00 - € 624.00
Specifications
| Antigen | GABA-A R beta 1 |
|---|---|
| Dilution | Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200 |
| Applications | Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18463892
|
Novus Biologicals
NBP2-14034-25ul |
25 μL |
€ 415.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18407781
|
Novus Biologicals
NBP2-14034 |
0.1 mL |
€ 624.00
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
GABA-A R beta 1 Polyclonal antibody specifically detects GABA-A R beta 1 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)Specifications
| GABA-A R beta 1 | |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| Rabbit | |
| Neuronal Cell Markers, Neuroscience, Neurotransmission | |
| PBS (pH 7.2) and 40% Glycerol | |
| 2560 | |
| IgG | |
| Immunogen affinity purified |
| Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200 | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human | |
| GABA(A) receptor subunit beta-1, gamma-aminobutyric acid (GABA) A receptor, beta 1, gamma-aminobutyric acid receptor subunit beta-1 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids: IFFGKGPQKKGASKQDQSANEKNKLEMNKVQVDAHGNI | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title