missing translation for 'onlineSavingsMsg'
Learn More
Learn More
GABA-A R delta Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody has been used in 1 publication
€ 280.00 - € 589.00
Specifications
| Antigen | GABA-A R delta |
|---|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18419341
|
Novus Biologicals
NBP2-33421-25ul |
25 μL |
€ 280.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18140185
|
Novus Biologicals
NBP2-33421 |
0.1 mL |
€ 589.00
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
GABA-A R delta Polyclonal specifically detects GABA-A R delta in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
| GABA-A R delta | |
| Polyclonal | |
| Rabbit | |
| Human | |
| O14764 | |
| 2563 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: KVKVSRPRAEMDVRNAIVLFSLSAAGVTQELAISRRQRRVPGNLMGSYRSVGVETGETKKEGAARSGGQGGIRARL | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| EIG10, EJM7, GABA(A) receptor subunit delta, GABA-A receptor, delta polypeptide, gamma-aminobutyric acid (GABA) A receptor, delta, gamma-aminobutyric acid receptor subunit delta, GEFSP5, MGC45284 | |
| GABRD | |
| IgG | |
| Affinity Purified | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title