missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Galanin Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody has been used in 1 publication
€ 369.00 - € 559.00
Specifications
| Antigen | Galanin |
|---|---|
| Dilution | Immunohistochemistry 1:1000 - 1:2500, Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml, Immunohistochemistry-Paraffin 1:1000 |
| Applications | Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18442192
|
Novus Biologicals
NBP2-33582-25ul |
25 μL |
€ 369.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18139764
|
Novus Biologicals
NBP2-33582 |
0.1 mL |
€ 559.00
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
Galanin Polyclonal specifically detects Galanin in Human, Monkey samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.Specifications
| Galanin | |
| Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| Human, Monkey | |
| P22466 | |
| 51083 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: GPHAVGNHRSFSDKNGLTSKRELRPEDDMKPGSFDRSIPENNIMRTIIEFLSFLHLKEAGALDRLLDLPAAASSEDIERS | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Immunohistochemistry 1:1000 - 1:2500, Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml, Immunohistochemistry-Paraffin 1:1000 | |
| Polyclonal | |
| Rabbit | |
| GPCR, Neuroscience | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| GAL1, galanin, galanin prepropeptide, GALNgalanin-related peptide, GLNNgalanin-message-associated peptide, GMAP, MGC40167 | |
| GAL | |
| IgG | |
| Affinity Purified | |
| Specificity of human Galanin antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title