missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Galectin-4 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-48607
This item is not returnable.
View return policy
Description
Galectin-4 Polyclonal antibody specifically detects Galectin-4 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)
Specifications
| Galectin-4 | |
| Polyclonal | |
| Immunohistochemistry 1:500 - 1:1000, Immunohistochemistry-Paraffin 1:500 - 1:1000 | |
| Antigen NY-CO-27, gal-4, GAL4, galectin 4, galectin-4, L-36 lactose-binding protein, L36LBP, Lactose-binding lectin 4, lectin, galactoside-binding, soluble, 4 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: IALHINPRMGNGTVVRNSLLNGSWGSEEKKITHNPFGPGQFFDLSIRCGLDRFKVYANGQHLFDFAHRLSAFQRVDTLEIQGDV | |
| 0.1 mL | |
| Cancer | |
| 3960 | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. | |
| IgG |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2), 40% Glycerol | |
| Rabbit | |
| Immunogen affinity purified | |
| RUO | |
| Primary | |
| Human | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction