missing translation for 'onlineSavingsMsg'
Learn More
Learn More
GALNT6, Mouse anti-Human, Clone: 4C10, Abnova™
Description
Sequence: IMYSCHGLGGNQYFEYTTQRDLRHNIAKQLCLHVSKGALGLGSCHFTGKNSQVPKDEEWELAQDQLIRNSGSGTCLTSQDKKPAMAPCNPSDPHQLWLFV
Specifications
Specifications
| Antigen | GALNT6 |
| Applications | ELISA, KnockDown, Western Blot |
| Classification | Monoclonal |
| Clone | 4C10 |
| Conjugate | Unconjugated |
| Formulation | In 1x PBS, pH 7.4 |
| Gene | UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase 6 (GalNAc-T6) |
| Gene Accession No. | NM_007210 |
| Gene Alias | GALNAC-T6/GalNAcT6 |
| Gene Symbols | GALNT6 |
| Show More |
Product Title
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
Spot an opportunity for improvement?