missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Gasdermin-A Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-49426-25ul
This item is not returnable.
View return policy
Description
Gasdermin-A Polyclonal antibody specifically detects Gasdermin-A in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)
Specifications
| Gasdermin-A | |
| Polyclonal | |
| Immunohistochemistry 1:1000 - 1:2500, Immunohistochemistry-Paraffin 1:1000 - 1:2500 | |
| FKSG9, Gasdermin, Gasdermin 1, Gasdermin A, Gasdermin-1, GSDM, GSDM1 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: DLTPLDSLIDFKRFHPFCLVLRKRKSTLFWGARYVRTDYTLLDVLEPGSSPSDPTDTGNFGFKNMLDTRVEGDVDVPKTVKVKGTAG | |
| 25 μL | |
| Primary | |
| Human | |
| Purified |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2), 40% Glycerol | |
| Rabbit | |
| Immunogen affinity purified | |
| RUO | |
| 284110 | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction