missing translation for 'onlineSavingsMsg'
Learn More
Learn More
GDF-7/BMP-12 Antibody (3C2), Novus Biologicals™
Mouse Monoclonal Antibody
Brand: Novus Biologicals H00151449-M04
This item is not returnable.
View return policy
Description
GDF-7/BMP-12 Monoclonal antibody specifically detects GDF-7/BMP-12 in Human samples. It is validated for Western Blot, ELISA
Specifications
| GDF-7/BMP-12 | |
| Monoclonal | |
| Unconjugated | |
| In 1x PBS, pH 7.4 | |
| BMP12, GDF-7, growth differentiation factor 7, growth/differentiation factor 7 | |
| GDF7 (NP_878248, 361 a.a. ∽ 450 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. LGWDDWIIAPLDYEAYHCEGLCDFPLRSHLEPTNHAIIQTLLNSMAPDAAPASCCVPARLSPISILYIDAANNVVYKQYEDMVVEACGCR | |
| 0.1 mg | |
| Cytokine Research | |
| 151449 | |
| Aliquot and store at -20°C or -80°C. Avoid freeze-thaw cycles. | |
| IgG2a κ |
| Western Blot, ELISA | |
| 3C2 | |
| Western Blot 1:500, ELISA | |
| NP_878248 | |
| Mouse | |
| IgG purified | |
| RUO | |
| Primary | |
| Human | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction